Article
Isolation and characterization of an olive allergen-like protein from lilac pollen. Sequence analysis of three cDNA encoding protein isoforms
| Id | 1005 |
|---|---|
| Pubmed | 7513281 |
Authors
Batanero,E.; Villalba,M.; Lopez-Otin,C.; Rodriguez,R.
Title
Isolation and characterization of an olive allergen-like protein from lilac pollen. Sequence analysis of three cDNA encoding protein isoforms
Journal
Eur. J. Biochem. 221 (1), 187-193 (1994)
Pubmed ID
7513281Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 321 | Syringa vulgaris | lilac | Ole e 1-like | 0000631911 | S43242 | 145 | 1005, 2356, 2457 | 2007 | EDVPQPPIPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDRENGKITFTEIGYTR AEGLYSMLVEGDHKNEFCEITLISSGREDCDEIPVEGWAKPSLKFKLNTVNGTTRTINPI GFFKKEALPKCTQVYNKLGMYPPNM | >S43242 Syr v 1; Ole e 1-like [Syringa vulgaris] | View Edit Delete |
| 322 | Syringa vulgaris | lilac | Ole e 1-like | 0000631912 | S43243 | 145 | 1005, 2356, 2457 | 2007 | EDVPQPPVPQFHIQGQVYCDTCRARFITELSEFIPGAGIRLQCKDGEHGKITFTEIGYTR AEGLYSMLVEGDHKNEFCEITLLSSSRKDCEEIPIEGWVKPSLKFILNTVNGTTRTINPL GFFKKEVLPKCPQVFNKLGMYPPNM | >S43243 Syr v 1; Ole e 1-like [Syringa vulgaris] | View Edit Delete |
| 323 | Syringa vulgaris | lilac | Ole e 1-like | 0000631913 | S43244 | 145 | 1005, 2356, 2457 | 2007 | EDVPQPPVPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDGENGKITFTEIGYTR AEGLYSMLVEGDHKNEFCEITLISSGRKDCDEIPVEGWVKPSLKFKLNTVNGTTRTINPI GFFKKEALPKCTQVYNKLGMYPPNM | >S43244 Syr v 1; Ole e 1-like [Syringa vulgaris] | View Edit Delete |