Article
Setae from the pine processionary moth (Thaumetopoea pityocampa) contain several relevant allergens
| Id | 19294 |
|---|---|
| Pubmed | 22708991 |
Authors
Rodriguez-Mahillo,A.I.; Gonzalez-Munoz,M.; Vega,J.M.; Lopez,J.A.; Yart,A.; Kerdelhue,C.; Camafeita,E.; Garcia Ortiz,J.C.; Vogel,H.; Petrucco Toffolo,E.; Zovi,D.; Battisti,A.; Roques,A.; Moneo,I.;
Title
Setae from the pine processionary moth (Thaumetopoea pityocampa) contain several relevant allergens
Journal
Contact Derm. 67 (6), 367-374 (2012)
Pubmed ID
22708991Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1744 | Thaumetopoea pityocampa | pine processionary moth | unknown function | 0301030229 | ADK47876.1 | 126 | 2357, 2458, 19294 | 2012 | MKLLILALTCAAAVWARPGETYSDKYDTIDVNEVLQSERLLKGYVECLLDKGRCTPDGKE LKDTLPDALEHECSKCTEKQKSGADTVIRHLVNKRPELWKELAVKYDPENIYQERYKDRL ESVKEH | >ADK47876.1 Tha p 1; unknown function [Thaumetopoea pityocampa] | View Edit Delete |
| 1885 | Thaumetopoea pityocampa | pine processionary moth | unknown function | 0408387552 | P86360.1 | 115 | 19294 | 2014 | MKLLIFAILIALSSSVPQLSEKAEEAVDLAYQEKNNLFDLGSVAGDILSRSGCHVSFGCH KGYCWAGCGDPTNPWSWGENWCYTTKSYSQSYSYVQCTQDSECDGCWKCGGPCSA | >P86360.1 Tha p 2; unknown function [Thaumetopoea pityocampa] | View Edit Delete |
| 2243 | Thaumetopoea pityocampa | pine processionary moth | unknown function, partial | COMPARE158 | 22 | 19294 | 2020H_MS | SYSQSYSYVQCIQDSECNGCWK | >COMPARE158 Tha p 2; unknown function, partial [Thaumetopoea pityocampa] | View Edit Delete | |
| 2244 | Thaumetopoea pityocampa | pine processionary moth | unknown function, partial | COMPARE159 | 13 | 19294 | 2020H_MS | KAEEAIDLTYQEK | >COMPARE159 Tha p 2; unknown function, partial [Thaumetopoea pityocampa] | View Edit Delete | |
| 2245 | Thaumetopoea pityocampa | pine processionary moth | unknown function, partial | COMPARE160 | 16 | 19294 | 2020H_MS | NNLFNLGSVAGDILSR | >COMPARE160 Tha p 2; unknown function, partial [Thaumetopoea pityocampa] | View Edit Delete |