Article
The maize major allergen, which is responsible for food-induced allergic reactions, is a lipid transfer protein.
| Id | 2361 |
|---|---|
| Pubmed | 11031346 |
Authors
Pastorello EA; Farioli L; Pravettoni V; Ispano M; Scibola E; Trambaioli C; Giuffrida MG; Ansaloni R; Godovac-Zimmermann J; Conti A; Fortunato D; Ortolani C
Title
The maize major allergen, which is responsible for food-induced allergic reactions, is a lipid transfer protein.
Journal
J Allergy Clin Immunol. 2000 Oct;106(4):744-51
Pubmed ID
11031346Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 88 | Hordeum vulgare | barley | lipid transfer protein | 0000019039 | CAA42832.1 | 134 | 1323, 2361, 2402, 2404 | 2007 | MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDL HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRFTERR SVKLVLSSSIHVEL | >CAA42832.1 lipid transfer protein [Hordeum vulgare] | View Edit Delete |
| 182 | Hordeum vulgare | barley | lipid transfer protein | 0000167077 | AAA32970.1 | 117 | 1323, 2361, 2402, 2404 | 2007 | MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDL HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY | >AAA32970.1 lipid transfer protein [Hordeum vulgare] | View Edit Delete |
| 185 | Zea mays | corn | lipid transfer protein | 0000168576 | AAA33493.1 | 120 | 2361, 2484 | 2015 | MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN | >AAA33493.1 Zea m 14; lipid transfer protein [Zea mays] | View Edit Delete |
| 186 | Zea mays | corn | lipid transfer protein | 0000168578 | AAA33494.1 | 99 | 2361, 2484 | 2015 | SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG LNAGNAASIPSKCGVSIPYTISTSTDCSRYSRRMHASAD | >AAA33494.1 Zea m 14; lipid transfer protein [Zea mays] | View Edit Delete |