Article
Occupational asthma and rhinitis related to laboratory rats: serum IgG and IgE antibodies to the rat urinary allergen.
| Id | 2439 |
|---|---|
| Pubmed | 3819230 |
Authors
Platts-Mills TA; Longbottom J; Edwards J; Cockroft A; Wilkins S
Title
Occupational asthma and rhinitis related to laboratory rats: serum IgG and IgE antibodies to the rat urinary allergen.
Journal
J Allergy Clin Immunol. 1987 Mar;79(3):505-15
Pubmed ID
3819230Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 152 | Rattus norvegicus | rat | lipocalin, urinary globulin | 0000127533 | P02761.1 | 181 | 2293, 2439, 2440 | 2007 | MKLLLLLLCLGLTLVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVF MQHIDVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYV MFHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQAR G | >P02761.1 Rat n 1; lipocalin, urinary globulin [Rattus norvegicus] | View Edit Delete |
| 211 | Rattus norvegicus | rat | lipocalin, urinary globulin | 0000204261 | AAA41198.1 | 177 | 2293, 2439, 2440 | 2015 | LLLLCLGLTLVCGHAEEASSTSGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHI DVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHL INFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG | >AAA41198.1 Rat n 1; lipocalin, urinary globulin [Rattus norvegicus] | View Edit Delete |
| 1295 | Rattus norvegicus | rat | lipocalin, urinary globulin | 0081890324 | Q63213 | 181 | 2293, 2439, 2440 | 2007 | MKLLLLLLCLGLTLVCGHAEEASFERGNLDVDKLNGDWFSIVVASDKREKIEENGSMRVF VQHIDVLENSLGFTFRIKENGVCTEFSLVADKTAKDGEYFVEYDGENTFTILKTDYDNYV MFHLVNVNNGETFQLMELYGRTKDLSSDIKEKFAKLCVAHGITRDNIIDLTKTDRCLQAR G | >Q63213 Rat n 1; lipocalin, urinary globulin [Rattus norvegicus] | View Edit Delete |