Article
Peels of Rosaceae fruits have a higher allergenicity than pulps.
| Id | 2445 |
|---|---|
| Pubmed | 10469033 |
Authors
Fernandez-Rivas M; Cuevas M
Title
Peels of Rosaceae fruits have a higher allergenicity than pulps.
Journal
Clin Exp Allergy. 1999 Sep;29(9):1239-47
Pubmed ID
10469033Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 725 | Pyrus communis | pear | lipid transfer protein | 0006715524 | AAF26451.1 | 115 | 2436, 2445, 17952 | 2011 | MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPPACCNGIKTING LAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK | >AAF26451.1 Pyr c 3; lipid transfer protein [Pyrus communis] | View Edit Delete |
| 1853 | Pyrus communis | pear | lipid transfer protein | 0355525856 | AET05730.1 | 94 | 2436, 2445, 17952 | 2013 | AHAITCSQVSSNLAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGS VSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK | >AET05730.1 Pyr c 3; lipid transfer protein [Pyrus communis] | View Edit Delete |
| 1854 | Pyrus communis | pear | lipid transfer protein | 0355525860 | AET05732.1 | 94 | 2436, 2445, 17952 | 2013 | AHAITCSQVSSNLAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGS VSGVNPGNAESLPGKCGVNVPCKISTPTNCATVK | >AET05732.1 Pyr c 3; lipid transfer protein [Pyrus communis] | View Edit Delete |
| 1855 | Pyrus communis | pear | lipid transfer protein, partial | 0355525862 | AET05733.1 | 94 | 2436, 2445, 17952 | 2013 | AHAITCSQVTSNLGACIGYVKNGGVVPPACCNGIRTVNGLARTTADRQTTCNCLKSLAGS IKGVNPNNAATLPGKCGVNVPFKISTSTNCATVK | >AET05733.1 lipid transfer protein, partial [Pyrus communis] | View Edit Delete |