Article
Myrmecia pilosula (Jack Jumper) ant venom: identification of allergens and revised nomenclature.
| Id | 9491 |
|---|---|
| Pubmed | 17362256 |
Authors
Wiese MD; Brown SG; Chataway TK; Davies NW; Milne RW; Aulfrey SJ; Heddle RJ
Title
Myrmecia pilosula (Jack Jumper) ant venom: identification of allergens and revised nomenclature.
Journal
Allergy. 2007 Apr;62(4):437-43
Pubmed ID
17362256Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 448 | Myrmecia pilosula | jumper ant | pilosulin | 0001438761 | AAB36316.1 | 75 | 1098, 9489, 9491 | 2010 | MKLSCLLLTLAIIFVLTIVHAPNVEAKALADPESDAVGFADAVGEADPIDWKKVDWKKVS KKTCKVMLKACKFLG | >AAB36316.1 Myr p 2; pilosulin [Myrmecia pilosula] | View Edit Delete |
| 479 | Myrmecia pilosula | jumper ant | pilosulin | 0001587177 | 2206305A | 75 | 1098, 9489, 9491 | 2007 | MKLSCLLLTLAIIFVLTIVHAPNVEAKALADPESDAVGFADAVGGADPIDWKKVDWKKVS KKTCKVMLKACKFLG | >2206305A Myr p 2; pilosulin [Myrmecia pilosula] | View Edit Delete |
| 1155 | Myrmecia banksi | giant bull ant | pilosulin | 0051241753 | BAD36780.1 | 84 | 2564, 9489, 9491, 20033 | 2015 | MKLSCLLLTLAIIFVLTIVHAPNVKAKALADPESDAVGFADAVGEADPFDITKLNIKKLT KATCKVISKGASMCKVLFDKKKQE | >BAD36780.1 Myr p 3; pilosulin [Myrmecia banksi] | View Edit Delete |