Allergen

1ESF_B

Accession 1ESF_B
External DB Link NCBI Protein
Species Staphylococcus aureus
Common Name bacteria
Description enterotoxin
IUIS Name
Length 233
Year Adopted 2009
Sequence >1ESF_B enterotoxin [Staphylococcus aureus]
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTD
HSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLT
EEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQ
RGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Parent Accession

Related Articles

Pubmed Authors Title Journal
9396971 Nissen D; Pedersen LJ; Skov PS; Vejlsgaard GL; Poulsen LK; Jarløv JO; Karlsmark T; Nolte H IgE-binding components of staphylococcal enterotoxins in patients with atopic dermatitis. Ann Allergy Asthma Immunol. 1997 Nov;79(5):403-8
9893195 Bunikowski R; Mielke M; Skarabis H; Herz U; Bergmann RL; Wahn U; Renz H Prevalence and role of serum IgE antibodies to the Staphylococcus aureus-derived superantigens SEA and SEB in children with atopic dermatitis. J Allergy Clin Immunol. 1999 Jan;103(1 Pt 1):119-24
7690780 Leung DY; Harbeck R; Bina P; Reiser RF; Yang E; Norris DA; Hanifin JM; Sampson HA Presence of IgE antibodies to staphylococcal exotoxins on the skin of patients with atopic dermatitis. Evidence for a new group of allergens. J Clin Invest. 1993 Sep;92(3):1374-80
14976395 Rossi RE; Monasterolo G Prevalence of serum IgE antibodies to the Staphylococcus aureus enterotoxins (SAE, SEB, SEC, SED, TSST-1) in patients with persistent allergic rhinitis. Int Arch Allergy Immunol. 2004 Mar;133(3):261-6
18621391 Ong PY; Patel M; Ferdman RM; Dunaway T; Church JA Association of staphylococcal superantigen-specific immunoglobulin e with mild and moderate atopic dermatitis. J Pediatr. 2008 Dec;153(6):803-6
N/A: See Journal Bergdoll MC; Wong ACL Staphylococcal intoxications book: Foodborne Infections and Intoxications 2006