Allergen

1L3P_A

Accession 1L3P_A
External DB Link NCBI Protein
Species Phleum pratense
Common Name common timothy
Description unknown function, partial
IUIS Name Phl p 5
Length 102
Year Adopted 2007
Sequence >1L3P_A Phl p 5; unknown function, partial [Phleum pratense]
IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKETTGGAYDTYKCIPSL
EAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ
Parent Accession

Related Articles

Pubmed Authors Title Journal
7691956 Vrtala,S.; Sperr,W.R.; Reimitzer,I.; van Ree,R.; Laffer,S.; Mueller,W.D.; Valent,P.; Lechner,K.; Rumpold,H.; Kraft,D.; Scheiner,O.; Valenta,R. cDNA cloning of a major allergen from timothy grass (Phleum pratense) pollen; characterization of the recombinant Phl pV allergen J. Immunol. 151 (9), 4773-4781 (1993)
1863892 Matthiesen,F.; Lowenstein,H. Group V allergens in grass pollens. I. Purification and characterization of the group V allergen from Phleum pratense pollen, Phl p V Clin. Exp. Allergy 21 (3), 297-307 (1991)
9249029 Gehlhar,K.; Petersen,A.; Schramm,G.; Becker,W.M.; Schlaak,M.; Bufe,A. Investigation of different recombinant isoforms of grass group-V allergens (timothy grass pollen) isolated by low-stringency cDNA hybridization--antibody binding capacity and allergenic activity Eur. J. Biochem. 247 (1), 217-223 (1997)
1597349 Valenta R; Vrtala S; Ebner C; Kraft D; Scheiner O Diagnosis of grass pollen allergy with recombinant timothy grass (Phleum pratense) pollen allergens. Int Arch Allergy Immunol. 1992;97(4):287-94
9500760 Niederberger V; Laffer S; Froschl R; Kraft D; Rumpold H; Kapiotis S; Valenta R; Spitzauer S IgE antibodies to recombinant pollen allergens (Phl p 1, Phl p 2, Phl p 5, and Bet v 2) account for a high percentage of grass pollen-specific IgE. J Allergy Clin Immunol. 1998 Feb;101(2 Pt 1):258-64