Allergen

1WKX_A

Accession 1WKX_A
Species Hevea brasiliensis
Common Name Para rubber tree
Description hevein, partial
IUIS Name Hev b 6
Gi 0073535415
Length 43
Year Adopted 2007
Sequence >1WKX_A Hev b 6; hevein, partial [Hevea brasiliensis]
EQCGRQAGGKLCPDNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Parent Accession

Related Articles

Pubmed Authors Title Journal
9824416 Rozynek,P.; Posch,A.; Baur,X. Cloning, expression and characterization of the major latex allergen prohevein Clin. Exp. Allergy 28 (11), 1418-1426 (1998)
12642845 Bernstein DI; Biagini RE; Karnani R; Hamilton R; Murphy K; Bernstein C; Arif SA; Berendts B; Yeang HY In vivo sensitization to purified Hevea brasiliensis proteins in health care workers sensitized to natural rubber latex. J Allergy Clin Immunol. 2003 Mar;111(3):610-6
15627782 Wagner S; Breiteneder H Hevea brasiliensis latex allergens: current panel and clinical relevance. Int Arch Allergy Immunol. 2005 Jan;136(1):90-7
10828719 Yip L; Hickey V; Wagner B; Liss G; Slater J; Breiteneder H; Sussman G; Beezhold D Skin prick test reactivity to recombinant latex allergens. Int Arch Allergy Immunol. 2000 Apr;121(4):292-9
16618365 Sanz ML; Garcia-Aviles MC; Tabar AI; Anda M; Garcia BE; Barber D; Salcedo G; Rihs HP; Raulf-Heimsoth M Basophil Activation Test and specific IgE measurements using a panel of recombinant natural rubber latex allergens to determine the latex allergen sensitization profile in children. Pediatr Allergy Immunol. 2006 Mar;17(2):148-56