Allergen

1Z3Q_A

Accession 1Z3Q_A
Species Musa acuminata
Common Name banana
Description thaumatin-like
IUIS Name Mus a 4
Gi 0088191901
Length 200
Year Adopted 2007
Sequence >1Z3Q_A Mus a 4; thaumatin-like [Musa acuminata]
ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC
QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIR
CAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPKD
DQTTTFTCPGGTNYRVVFCP
Parent Accession

Related Articles

Pubmed Authors Title Journal
16085352 Leone,P.; Menu-Bouaouiche,L.; Peumans,W.J.; Payan,F.; Barre,A.; Roussel,A.; Van Damme,E.J.; Rouge,P.; Resolution of the structure of the allergenic and antifungal banana fruit thaumatin-like protein at 1.7-A Biochimie 88 (1), 45-52 (2006)
21284746 Palacin A; Quirce S; Sanchez-Monge R; Bobolea I; Diaz-Perales A; Martin-Muñoz F; Pascual C; Salcedo G Sensitization profiles to purified plant food allergens among pediatric patients with allergy to banana. Pediatr Allergy Immunol. 2011 Mar;22(2):186-95
24887593 Nikolic J; Mrkic I; Grozdanovic M; Popovic M; Petersen A; Jappe U; Gavrovic-Jankulovic M Protocol for simultaneous isolation of three important banana allergens. J Chromatogr B Analyt Technol Biomed Life Sci. 2014 May 21;962C:30-36