Allergen

2MC9_A

Accession 2MC9_A
External DB Link NCBI Protein
Species Catharanthus roseus
Common Name Madagascar periwinkle
Description cyclophilin/peptidyl-prolyl isomerase
IUIS Name Cat r 1
Length 178
Year Adopted 2016
Sequence >2MC9_A Cat r 1; cyclophilin/peptidyl-prolyl isomerase [Catharanthus roseus]
GSFTGSMPNPRVFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLH
YKDSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNT
NGSQFFICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQLS
Parent Accession

Related Articles

Pubmed Authors Title Journal
17655175 Ghosh D; Roy I; Chanda S; Gupta-Bhattacharya S Allergy to periwinkle pollen (Catharanthus roseus G. Don.). Ann Agric Environ Med. 2007;14(1):39-43
24939849 Ghosh D; Mueller GA; Schramm G; Edwards LL; Petersen A; London RE; Haas H; Gupta Bhattacharya S Primary identification, biochemical characterization, and immunologic properties of the allergenic pollen cyclophilin cat R 1. J Biol Chem. 2014 Aug 1;289(31):21374-85