Allergen

4ZCE_A

Accession 4ZCE_A
External DB Link NCBI Protein
Species Dermatophagoides pteronyssinus
Common Name house dust mite
Description peritrophin
IUIS Name Der p 23
Length 50
Year Adopted 2018
Sequence >4ZCE_A Der p 23; peritrophin [Dermatophagoides pteronyssinus]
SFTKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT
Parent Accession

Related Articles

Pubmed Authors Title Journal
23460742 Weghofer,M.; Grote,M.; Resch,Y.; Casset,A.; Kneidinger,M.; Kopec,J.; Thomas,W.R.; Fernandez-Caldas,E.; Kabesch,M.; Ferrara,R.; Mari,A.; Purohit,A.; Pauli,G.; Horak,F.; Keller,W.; Valent,P.; Valenta,R.; Vrtala,S.; Identification of Der p 23, a Peritrophin-like Protein, as a New Major Dermatophagoides pteronyssinus Allergen Associated with the Peritrophic Matrix of Mite Fecal Pellets J. Immunol. 190 (7), 3059-3067 (2013)
26602749 Mueller,G.A., Randall,T.A., Glesner,J., Pedersen,L.C., Perera,L., Edwards,L.L., DeRose,E.F., Chapman,M.D., London,R.E. and Pomes,A. Serological, genomic and structural analyses of the major mite allergen Der p 23 Clin. Exp. Allergy 46 (2), 365-376 (2016)