Allergen

A0A161X1M2

Accession A0A161X1M2
Species Daucus carota
Common Name carrot
Description pathogenesis related protein, PR-10, Bet v 1-like protein
IUIS Name Dau c 1
Gi
Length 155
Year Adopted 2022
Sequence >A0A161X1M2 Allergen Dau c 1; pathogenesis related protein, PR-10, Bet v 1-like protein [Daucus carota]
MGVQKTEAEVTSSVSAEKLFKALCLDIDTLLPQVLPGAIKSSETLEGDGGVGTVKLVHLG
DASPFKTMKQKVDAIDKESFTYAYSIIDGDILLGFIESINNHFAYVPNADGGCTVKSTIT
FNTKGDAVVPEENIKFANDQNRAIFQAVEAYLIAN
Parent Accession