Allergen

A0A484HRI4

Accession A0A484HRI4
Species Cavia porcellus
Common Name domestic guinea pig
Description lipocalin
IUIS Name Cav p 1
Gi
Length 166
Year Adopted 2022
Sequence >A0A484HRI4 Allergen Cav p 1; lipocalin [Cavia porcellus]
MVQILLLALAVGLSCVESSQISGDWDTIALSADNKEKIEEGGPLRVYFRQIDCNADCSEI
TFRLYVKLNGECKESTVVASQSLGGLYTVQFAGQNTFVIVDKQEDTITFFNTNVDENGLV
TRGYVVVGKRDSLTPEETLSFEEANEVKGIPQENIEYLAGTDDCPE
Parent Accession