Allergen

AAA28301.1

Accession AAA28301.1
External DB Link NCBI Protein
Species Dolichovespula maculata
Common Name whiteface hornet
Description unknown function, antigen 5
IUIS Name Dol m 5
Length 227
Year Adopted 2011
Sequence >AAA28301.1 Dol m 5; unknown function, antigen 5 [Dolichovespula maculata]
MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLT
NDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFN
HDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHY
TQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYERK
Parent Accession

Related Articles

Pubmed Authors Title Journal
3422469 Fang,K.S.; Vitale,M.; Fehlner,P.; King,T.P. cDNA cloning and primary structure of a white-face hornet venom allergen, antigen 5 Proc. Natl. Acad. Sci. U.S.A. 85 (3), 895-899 (1988)
8454859 Lu,G.; Villalba,M.; Coscia,M.R.; Hoffman,D.R.; King,T.P. Sequence analysis and antigenic cross-reactivity of a venom allergen, antigen 5, from hornets, wasps, and yellow jackets J. Immunol. 150 (7), 2823-2830 (1993)
2402482 King,T.P.; Moran,D.; Wang,D.F.; Kochoumian,L.; Chait,B.T. Structural studies of a hornet venom allergen antigen 5, Dol m V and its sequence similarity with other proteins Protein Seq. Data Anal. 3 (3), 263-266 (1990)
3989146 Hoffman DR Allergens in Hymenoptera venom XIV: IgE binding activities of venom proteins from three species of vespids. J Allergy Clin Immunol. 1985 May;75(5):606-10
3989145 Hoffman DR Allergens in Hymenoptera venom XIII: Isolation and purification of protein components from three species of vespid venoms. J Allergy Clin Immunol. 1985 May;75(5):599-605
16197464 Bilo BM; Rueff F; Mosbech H; Bonifazi F; Oude-Elberink JN; the EAACI Interest Group on Insect Venom Hypersensitivity* Diagnosis of Hymenoptera venom allergy. Allergy. 2005 Nov;60(11):1339-49