Allergen

AAA63279.1

Accession AAA63279.1
External DB Link NCBI Protein
Species Lolium perenne
Common Name perennial ryegrass
Description beta-expansin
IUIS Name Lol p 1
Length 263
Year Adopted 2010
Sequence >AAA63279.1 Lol p 1; beta-expansin [Lolium perenne]
MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP
NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG
GTKSEFEDVIPEGWKADTSYSAK
Parent Accession

Related Articles

Pubmed Authors Title Journal
2001733 Griffith,I.J.; Smith,P.M.; Pollock,J.; Theerakulpisut,P.; Avjioglu,A.; Davies,S.; Hough,T.; Singh,M.B.; Simpson,R.J.; Ward,L.D.; Knox,R.B. Cloning and sequencing of Lol pI, the major allergenic protein of rye-grass pollen FEBS Lett. 279 (2), 210-215 (1991)
3680810 Freidhoff LR; Ehrlich-Kautzky E; Meyers DA; Marsh DG A study of the human immune response to Lolium perenne (rye) pollen and its components, Lol p I and Lol p II (Rye I and Rye II). II. Longitudinal variation of antibody levels in relation to symptomatology and pollen exposure and correction of seasonally elevated antibody levels to basal values. J Allergy Clin Immunol. 1987 Nov;80(5):646-55
9066506 Boutin Y; Lamontagne P; Boulanger J; Brunet C; Hebert J Immunological and biological properties of recombinant Lol p 1. Int Arch Allergy Immunol. 1997 Mar;112(3):218-25
9117883 Van Ree R; Van Leeuwen WA; Dieges PH; Van Wijk RG; De Jong N; Brewczyski PZ; Kroon AM; Schilte PP; Tan KY; Simon-Licht IF; Roberts AM; Stapel SO; Aalberse RC Measurement of IgE antibodies against purified grass pollen allergens (Lol p 1, 2, 3 and 5) during immunotherapy. Clin Exp Allergy. 1997 Jan;27(1):68-74
3782681 Freidhoff LR; Ehrlich-Kautzky E; Grant JH; Meyers DA; Marsh DG A study of the human immune response to Lolium perenne (rye) pollen and its components, Lol p I and Lol p II (rye I and rye II). I. Prevalence of reactivity to the allergens and correlations among skin test, IgE antibody, and IgG antibody data. J Allergy Clin Immunol. 1986 Dec;78(6):1190-201