Allergen

AAB01092.1

Accession AAB01092.1
External DB Link NCBI Protein
Species Daucus carota
Common Name carrot
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Dau c 1
Length 168
Year Adopted 2007
Sequence >AAB01092.1 Dau c 1; pathogenesis related protein, PR-10, Bet v 1-like [Daucus carota]
LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDVKG
DGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVP
TADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Parent Accession

Related Articles

Pubmed Authors Title Journal
10336602 Hoffmann-Sommergruber,K.; O'Riordain,G.; Ahorn,H.; Ebner,C.; Laimer Da Camara Machado,M.; Puhringer,H.; Scheiner,O.; Breiteneder,H. Molecular characterization of Dau c 1, the Bet v 1 homologous protein from carrot and its cross-reactivity with Bet v 1 and Api g 1 Clin. Exp. Allergy 29 (6), 840-847 (1999)
11496252 Ballmer-Weber BK; Wuthrich B; Wangorsch A; Fotisch K; Altmann F; Vieths S Carrot allergy: double-blinded, placebo-controlled food challenge and identification of allergens. J Allergy Clin Immunol. 2001 Aug;108(2):301-7
16008686 Ballmer-Weber BK; Wangorsch A; Bohle B; Kaul S; Kundig T; Fotisch K; van Ree R; Vieths S Component-resolved in vitro diagnosis in carrot allergy: does the use of recombinant carrot allergens improve the reliability of the diagnostic procedure? Clin Exp Allergy. 2005 Jul;35(7):970-8
17292955 Reese G; Ballmer-Weber BK; Wangorsch A; Randow S; Vieths S Allergenicity and antigenicity of wild-type and mutant, monomeric, and dimeric carrot major allergen Dau c 1: destruction of conformation, not oligomerization, is the roadmap to save allergen vaccines. J Allergy Clin Immunol. 2007 Apr;119(4):944-51