Allergen

AAB24432.1

Accession AAB24432.1
Species Alnus glutinosa
Common Name Alder
Description pathogenesis related protein, PR-10, Bet v 1-like protein
IUIS Name Aln g 1
Gi 0000261407
Length 160
Year Adopted 2007
Sequence >AAB24432.1 Allergen Aln g 1; pathogenesis related protein, PR-10, Bet v 1-like protein [Alnus glutinosa]
MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP
EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK
FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN
Parent Accession