Allergen

AAC82349.1

Accession AAC82349.1
External DB Link NCBI Protein
Species Euroglyphus maynei
Common Name house dust mite
Description NPC2-like
IUIS Name Eur m 2
Length 145
Year Adopted 2011
Sequence >AAC82349.1 Eur m 2; NPC2-like [Euroglyphus maynei]
MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN
QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV
VVTVKLLGDNGVLACAIATHAKIRD
Parent Accession

Related Articles

Pubmed Authors Title Journal
9925958 Smith,W.; Mills,K.; Hazell,L.; Hart,B.; Thomas,W. Molecular analysis of the group 1 and 2 allergens from the house dust mite, Euroglyphus maynei Int. Arch. Allergy Immunol. 118 (1), 15-22 (1999)
9275144 Morgan MS; Arlian LG; Barnes KC; Fernandez-Caldas E Characterization of the allergens of the house dust mite Euroglyphus maynei. J Allergy Clin Immunol. 1997 Aug;100(2):222-8