Allergen

AAD09630.1

Accession AAD09630.1
External DB Link NCBI Protein
Species Glycine max
Common Name soybean
Description 2S albumin, conglutin
IUIS Name Gly m 8
Length 155
Year Adopted 2014
Sequence >AAD09630.1 Gly m 8; 2S albumin, conglutin [Glycine max]
MTKLTILLIALLFIAHTCCASKWQQHQQESCREQLKGINLNPCEHIMEKIQAGRRGEDGS
DEDHILIRTMPGRINYIRKKEGKEEEEEGHMQKCCSEMSELKSPICQCKALQKIMDNQSE
QLEGKEKKQMERELMNLAIRCRLGPMIGCDLSSDD
Parent Accession

Related Articles

Pubmed Authors Title Journal
24117462 Klemans RJ; Knol EF; Michelsen-Huisman A; Pasmans SG; de Kruijf-Broekman W; Bruijnzeel-Koomen CA; van Hoffen E; Knulst AC Components in soy allergy diagnostics: Gly m 2S albumin has the best diagnostic value in adults. Allergy. 2013 Oct 10;
23763971 Ebisawa M; Brostedt P; Sjölander S; Sato S; Borres MP; Ito K Gly m 2S albumin is a major allergen with a high diagnostic value in soybean-allergic children. J Allergy Clin Immunol. 2013 Oct;132(4):976-8.e1-5
15134653 Lin J; Fido R; Shewry P; Archer DB; Alcocer MJ The expression and processing of two recombinant 2S albumins from soybean (Glycine max) in the yeast Pichia pastoris. Biochim Biophys Acta. 2004 May 6;1698(2):203-12
16837790 Lin J; Shewry PR; Archer DB; Beyer K; Niggemann B; Haas H; Wilson P; Alcocer MJ The potential allergenicity of two 2S albumins from soybean (Glycine max): a protein microarray approach. Int Arch Allergy Immunol. 2006;141(2):91-102