Allergen

AAD42943.1

Accession AAD42943.1
Species Sesamum indicum
Common Name Sesame
Description 2S albumin
IUIS Name Ses i 2
Gi 0005381323
Length 148
Year Adopted 2007
Sequence >AAD42943.1 Allergen Ses i 2; 2S albumin [Sesamum indicum]
MARFTIVLAVLFAAALVSASAHKTVVTTSVAEEGEEENQRGCEWESRQCQMRHCMQWMRS
MRGQYEESFLRSAEANQGQFEHFRECCNELRDVKSHCRCEALRCMMRQMQQEYGMEQEMQ
QMQQMMQYLPRMCGMSYPTECRMRPIFA
Parent Accession