Allergen

AAD56337.1

Accession AAD56337.1
Species Arachis hypogaea
Common Name Peanut
Description 2S albumin, conglutin
IUIS Name Ara h 6
Gi 0005923742
Length 129
Year Adopted 2007
Sequence >AAD56337.1 Allergen Ara h 6; 2S albumin, conglutin [Arachis hypogaea]
AHASAMRRERGRQGDSSSCERQVDGVNLKPCEQHIMQRIMGEQEQYDSYNFGSTRSSDQQ
QRCCDELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCNFGAPQRC
DLDVSGGRC
Parent Accession