Allergen

AAL92578.1

Accession AAL92578.1
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description beta-1,3-glucanase
IUIS Name Ole e 10
Length 123
Year Adopted 2007
Sequence >AAL92578.1 Ole e 10; beta-1,3-glucanase [Olea europaea]
MRGTAGVPDQPVPTPTPSVPTSSSPVPKPPTQGNKKWCVPKAEATDAQLQSNIDYVCSQS
GMDCGPIQANGACFNPNTVRAHASYAMNSWYQSKGRNDFDCDFSGTGAITSSDPSNGSCS
FLS
Parent Accession

Related Articles

Pubmed Authors Title Journal
15004167 Barral,P.; Batanero,E.; Palomares,O.; Quiralte,J.; Villalba,M.; Rodriguez,R.; A major allergen from pollen defines a novel family of plant proteins and shows intra- and interspecie cross-reactivity J. Immunol. 172 (6), 3644-3651 (2004)
15679723 Quiralte J; Llanes E; Barral P; Arias de Saavedra JM; Saenz de San Pedro B; Villalba M; Florido JF; Rodriguez R; Lahoz C; Cardaba B Ole e 2 and Ole e 10: new clinical aspects and genetic restrictions in olive pollen allergy. Allergy. 2005 Mar;60(3):360-5