Allergen

AAL92871.1

Accession AAL92871.1
External DB Link NCBI Protein
Species Chenopodium album
Common Name pigweed
Description calcium-binding protein, polcalcin
IUIS Name Che a 3
Length 86
Year Adopted 2007
Sequence >AAL92871.1 Che a 3; calcium-binding protein, polcalcin [Chenopodium album]
MAAEDTPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGD
GFISFDEFTDFARANRGLVKDVSKIF
Parent Accession

Related Articles

Pubmed Authors Title Journal
15208604 Barderas,R.; Villalba,M.; Pascual,C.Y.; Batanero,E.; Rodriguez,R. Profilin (Che a 2) and polcalcin (Che a 3) are relevant allergens of Chenopodium album pollen: isolation, amino acid sequences, and immunologic properties J. Allergy Clin. Immunol. 113 (6), 1192-1198 (2004)