Allergen

AAN77576.1

Accession AAN77576.1
Species Arachis hypogaea
Common Name Peanut
Description 2S albumin, conglutin
IUIS Name Ara h 2
Gi 0026245447
Length 172
Year Adopted 2007
Sequence >AAN77576.1 Allergen Ara h 2; 2S albumin, conglutin [Arachis hypogaea]
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSY
GRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEA
LQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
Parent Accession