Allergen

AAQ24549.1

Accession AAQ24549.1
Species Blomia tropicalis
Common Name mite
Description chitinase
IUIS Name
Gi
Length 461
Year Adopted 2022
Sequence >AAQ24549.1 chitinase [Blomia tropicalis]
MTKLCLVALATLATIAALVPVNHATKDPKTVCYYESWVHWRHGDGKMEPNEIDTSLCTHI
VYTYFGIDAITHELKWLDPYLMKDLHDIEKFVQAKGKAKAMIAIGGASMSDQFSITAGNE
QYRDIFARSVVNFLAQYHFDGIMIDWYGVQERDSENLIHLLDKFDEKFASTTYSMGITLP
ATVATLDHYNVPKITVYVDFINVLTLDYAGPWGKVVDNASPLPEQLKTMEEYHKRGAPRS
KLVMAVPMYARTWRLASPLHQDLGDAAISGGTKGPYTDTEGILSYNELCVRIKGSPNSFN
IVRDVANTAVHAVYLHGNEAEFYSFEDTKTLAAKAHNVTTMGYGGLSIFTLSNEDSHGTC
GKKYPLLHSIVENYNHDPIDEVPITTIPPPTPHPTEVVTDIPGVFKCHSVGKFRDHEYCF
KYYDCVMGDFGLESTVMYCERHQAFDEKTYKCVEASQIPGC
Parent Accession