Allergen

AAU21501.1

Accession AAU21501.1
Species Arachis hypogaea
Common Name peanut
Description oleosin
IUIS Name Ara h 15
Gi
Length 166
Year Adopted 2022
Sequence >AAU21501.1 Allergen Ara h 15; oleosin [Arachis hypogaea]
MSDQTRTGYGGGGSYGSSYGGGGTYGSSYGTSYDPSTNQPIRQAIKFMTASTIGVSFLIL
SGLILTGTVIGLIIATPLLVIFSPILVPAAITLALAAGGFLFSGGCGVAAIAALSWLYSY
VTGKHPAGSDRLDYAKGVIADKARDVKDRAKDYAGAGRAQEGTPGY
Parent Accession