Allergen

ABG73108.1

Accession ABG73108.1
Species Pistacia vera
Common Name pistachio
Description 2S albumin, conglutin
IUIS Name Pis v 1
Gi 0110349081
Length 149
Year Adopted 2010
Sequence >ABG73108.1 Allergen Pis v 1; 2S albumin, conglutin [Pistacia vera]
MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKFKHCQMYVQQE
VQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQE
LYETASELPRMCNISPSQGCQFSSPYWSY
Parent Accession