Allergen

ABL09307.1

Accession ABL09307.1
Species Acarus siro
Common Name Mite
Description fatty acid-binding protein
IUIS Name Aca s 13
Gi 0118638268
Length 131
Year Adopted 2009
Sequence >ABL09307.1 Allergen Aca s 13; fatty acid-binding protein [Acarus siro]
MVQINGSYKLEKSDNFDAFLKELGLNFVTRNLAKSATPTVEVSVNGDSYTIKTASTLKNT
EISFKLGEEFEEARADGKTVKTVVNKESDTKFVQVQQGDKEVTIVREFSDEGLTVTATVN
GVTSVRFYKRQ
Parent Accession