Allergen

ABM53750

Accession ABM53750
Species Tyrophagus putrescentiae
Common Name storage mite
Description bactericidal permeability-increasing like protein
IUIS Name Tyr p 7
Gi
Length 212
Year Adopted 2022
Sequence >ABM53750 Allergen Tyr p 7; bactericidal permeability-increasing like protein [Tyrophagus putrescentiae]
MKSAVLVLVACFAGIAVADNGNANQFVDQIVTALKTQKNFDPLVIPPHHMNIDRKIGAIH
LKGTADLKETKITGLSHVRRVGDALLKNENGSFTAKLHLGDDNVKLFSDISLHFLHNIIH
PNLKVEIDIGNIGVGFGVTIGADGKPALKDFDIEEFKHVKIHVHGLGPLDHLVDLIGEAY
ISLANTQARHMITGIVRPILDQELKNFKMGGF
Parent Accession