Allergen

ABM53753

Accession ABM53753
Species Tyrophagus putrescentiae
Common Name storage mite
Description cysteine protease
IUIS Name Tyr p 1
Gi
Length 336
Year Adopted 2022
Sequence >ABM53753 Allergen Tyr p 1; cysteine protease [Tyrophagus putrescentiae]
MALLFYILFLFFTFIQCRHLEKVPTWEQYKVKFGKNYLTINEENFRKNNYFNSLTKIVKN
NGKNGVTLGLNDMSDWSDEEFFSLNSKSPSSVFVSARPTSTVNTSPFPKSWDWRNIIAFN
SIEQQGRCSSCWAFAAATTVEAAYAHQKNKHNLHLSRQELVDCTNRTFDQHYLNYGCKGG
WPTEAYKYIMDHGVYEDKLYHYTETFNEVCYADKVAHDKGHPVKYYISNYGRLAYNDTDE
AIMAMLVTYGPGTVDIHGTSDTFRFYKGGIMRNVMPNSAYTNHIVVVVGYGTDSSGVDYW
IIRNSWGKTWGEHGYGRLERHPNLLGFNNKYNYPIL
Parent Accession