Allergen

ABO84968.1

Accession ABO84968.1
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description unknown function
IUIS Name Der f 21
Length 136
Year Adopted 2009
Sequence >ABO84968.1 Der f 21; unknown function [Dermatophagoides farinae]
MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDRMLMEEFEEKMDQIEHGLLMLSEQYKE
LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVPTIEILVK
DLAELAKKVKAVKSDD
Parent Accession

Related Articles

Pubmed Authors Title Journal
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53
7823971 ONeill GM, Donovan GR, Baldo BA Sequence analyses of the native form of a major house dust mite allergen and its nascent polypeptide. Mol Immunol. 1994 Dec;31(18):1447-8
18445190 Weghofer M; Dall Characterization of Der p 21, a new important allergen derived from the gut of house dust mites. Allergy. 2008 Jun;63(6):758-67