Allergen

ABS29033.1

Accession ABS29033.1
External DB Link NCBI Protein
Species Stemphylium sp.
Common Name fungus
Description Alt a 1-like
IUIS Name
Length 137
Year Adopted 2009
Sequence >ABS29033.1 Alt a 1-like [Stemphylium sp.]
LAAAAPFEARQADASCPVSTQGDYVWKISEFSGRKPEGTYYNSLSFNIKATNKGTLDFTC
SAQADKLEDDKFYSCGENSFMSFAFQSDRNGLLFRQDVSDEITYVATATLPNYCHAGGNG
PKDFVCQGVSDAYFTLV
Parent Accession

Related Articles

Pubmed Authors Title Journal
15670710 Hong,S.G.; Cramer,R.A.; Lawrence,C.B.; Pryor,B.M.; Alt a 1 allergen homologs from Alternaria and related taxa: analysis of phylogenetic content and secondary structure Fungal Genet. Biol. 42 (2), 119-129 (2005)
3453724 Lelong M; Henard J; Wattre P; Duprey J; Thelliez P; Miersman R [Does immediate-type respiratory allergy occur regarding Stemphylium? Evaluation of 39 challenge tests] Allerg Immunol (Paris). 1986 Oct;18(8):21, 23, 25-6
6183306 Agarwal MK; Jones RT; Yunginger JW Shared allergenic and antigenic determinants in Alternaria and Stemphylium extracts. J Allergy Clin Immunol. 1982 Dec;70(6):437-44
21504377 Gutiérrez-Rodríguez A; Postigo I; Guisantes JA; Suñén E; Martínez J Identification of allergens homologous to Alt a 1 from Stemphylium botryosum and Ulocladium botrytis. Med Mycol. 2011 Nov;49(8):892-6