Allergen

ABV55106.1

Accession ABV55106.1
External DB Link NCBI Protein
Species Anisakis simplex
Common Name parasitic fish worm
Description SXP/RAL-2 family protein
IUIS Name Ani s 9
Length 147
Year Adopted 2009
Sequence >ABV55106.1 Ani s 9; SXP/RAL-2 family protein [Anisakis simplex]
MKLCILAVAVFVVAVSAQGPPPLPPFVANAPPAVQAEFRQLANGAPDKTEAEIEAQIEQW
VASKGGAVQAEFNKFKQMLEQGKARAEAAHQASLTRLSPAAKAADARLSAIASNRALKVG
EKQRQLAAAFQALDPAVKAELQKEMQG
Parent Accession

Related Articles

Pubmed Authors Title Journal
18378015 Rodriguez-Perez,R.; Moneo,I.; Rodriguez-Mahillo,A.; Caballero,M.L.; Cloning and expression of Ani s 9, a new Anisakis simplex allergen Mol. Biochem. Parasitol. 159 (2), 92-97 (2008)
21310242 Caballero ML; Umpierrez A; Moneo I; Rodriguez-Perez R Ani s 10, a new Anisakis simplex allergen: cloning and heterologous expression. Parasitol Int. 2011 Jun;60(2):209-12
23092000 Pravettoni V; Primavesi L; Piantanida M Anisakis simplex: current knowledge. Eur Ann Allergy Clin Immunol. 2012 Aug;44(4):150-6
23742817 Quiazon KM; Zenke K; Yoshinaga T Molecular characterization and comparison of four Anisakis allergens between Anisakis simplex sensu stricto and Anisakis pegreffii from Japan. Mol Biochem Parasitol. 2013 Jul;190(1):23-6
23724976 del Carmen Romero M; Valero A; Navarro-Moll MC; Martín-Sánchez J Experimental comparison of pathogenic potential of two sibling species Anisakis simplex s.s. and Anisakis pegreffii in Wistar rat. Trop Med Int Health. 2013 Aug;18(8):979-84