Allergen

ABW17159.1

Accession ABW17159.1
Species Arachis hypogaea
Common Name Peanut
Description 2S albumin, conglutin
IUIS Name Ara h 7
Gi 0158121995
Length 164
Year Adopted 2010
Sequence >ABW17159.1 Allergen Ara h 7; 2S albumin, conglutin [Arachis hypogaea]
MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI
RQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL
QNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDLSSRTPY
Parent Accession