Allergen

ABX54869.1

Accession ABX54869.1
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description superoxide dismutase
IUIS Name Ole e 5
Length 152
Year Adopted 2009
Sequence >ABX54869.1 Ole e 5; superoxide dismutase [Olea europaea]
MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS
DPDDLGRGGHVLSKSTGNAGGRVACGIIGLQG
Parent Accession

Related Articles

Pubmed Authors Title Journal
9500754 Boluda,L.; Alonso,C.; Fernandez-Caldas,E. Purification, characterization, and partial sequencing of two new allergens of Olea europaea J. Allergy Clin. Immunol. 101 (2 PT 1), 210-216 (1998)
11490150 Rodriguez R; Villalba M; Monsalve RI; Batanero E The spectrum of olive pollen allergens. Int Arch Allergy Immunol. 2001 Jul;125(3):185-95
15785077 Butteroni C; Afferni C; Barletta B; Iacovacci P; Corinti S; Brunetto B; Tinghino R; Ariano R; Panzani RC; Pini C; Di Felice G Cloning and Expression of the Olea europaea allergen Ole e 5, the pollen Cu/Zn superoxide dismutase. Int Arch Allergy Immunol. 2005 May;137(1):9-17
22385802 Esteve,C.; Montealegre,C.; Marina,M.L.; Garcia,M.C.; Analysis of olive allergens Talanta 92, 1-14 (2012)
N/A: See Journal Alche,J.D.; Corpas,F.J.; Rodriguez-Garcia,M.I.; del Rio,L.A.; Identification and immunolocalization of superoxide dismutase isoenzymes of olive pollen Physiol. Plantarum 104, 772-776 (1998)