Allergen

ABZ81047.1

Accession ABZ81047.1
External DB Link NCBI Protein
Species Quercus alba
Common Name white oak
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Que a 1
Length 160
Year Adopted 2010
Sequence >ABZ81047.1 Que a 1; pathogenesis related protein, PR-10, Bet v 1-like [Quercus alba]
MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG
EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK
YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLYK
Parent Accession

Related Articles

Pubmed Authors Title Journal
1961201 Ipsen,H.; Hansen,O.C. The NH2-terminal amino acid sequence of the immunochemically partial identical major allergens of Alder (Alnus glutinosa) Aln g I, birch (Betula verrucosa) Bet v I, hornbeam (Carpinus betulus) Car b I and oak (Quercus alba) Que a I pollens Mol. Immunol. 28 (11), 1279-1288 (1991)
9802365 Niederberger V; Pauli G; Gronlund H; Froschl R; Rumpold H; Kraft D; Valenta R; Spitzauer S Recombinant birch pollen allergens (rBet v 1 and rBet v 2) contain most of the IgE epitopes present in birch, alder, hornbeam, hazel, and oak pollen: a quantitative IgE inhibition study with sera from different populations. J Allergy Clin Immunol. 1998 Oct;102(4 Pt 1):579-91
19170672 Wallner M; Erler A; Hauser M; Klinglmayr E; Gadermaier G; Vogel L; Mari A; Bohle B; Briza P; Ferreira F Immunologic characterization of isoforms of Car b 1 and Que a 1, the major hornbeam and oak pollen allergens. Allergy. 2009 Mar;64(3):452-60
22092996 Hauser M; Asam C; Himly M; Palazzo P; Voltolini S; Montanari C; Briza P; Bernardi ML; Mari A; Ferreira F; Wallner M Bet v 1-like pollen allergens of multiple Fagales species can sensitize atopic individuals. Clin Exp Allergy. 2011 Dec;41(12):1804-14
18268388 Movérare R; Everberg H; Carlsson R; Holtz A; Thunberg R; Olsson P; Brostedt P; Hogbom E Purification and characterization of the major oak pollen allergen Que a 1 for component-resolved diagnostics using ImmunoCAP. Int Arch Allergy Immunol. 2008;146(3):203-11