Allergen

ACI41244.1

Accession ACI41244.1
Species Sesamum indicum
Common Name Sesame
Description 2S albumin [Sesamum indicum]
IUIS Name
Gi 0209165427
Length 153
Year Adopted 2010
Sequence >ACI41244.1 Putative 2S albumin [Sesamum indicum]
MAKKLALAAVLLVAMVALASATTYTTTVTTTAIDDEANQQSQQCRQQLQGRQFRSCQRYL
SQGRSPYGGEEDEVLEMSTGNQQSEQSLRDCCQQLGNVDERCRCEAIRQAVRQQQQEGGY
QEGQSQQVYQRARDLPRRCNMRPQQCQFRVIFV
Parent Accession