Allergen

ACI41244.1

Accession ACI41244.1
External DB Link NCBI Protein
Species Sesamum indicum
Common Name sesame
Description 2S albumin, conglutin
IUIS Name Ses i 1
Length 153
Year Adopted 2010
Sequence >ACI41244.1 Ses i 1; 2S albumin, conglutin [Sesamum indicum]
MAKKLALAAVLLVAMVALASATTYTTTVTTTAIDDEANQQSQQCRQQLQGRQFRSCQRYL
SQGRSPYGGEEDEVLEMSTGNQQSEQSLRDCCQQLGNVDERCRCEAIRQAVRQQQQEGGY
QEGQSQQVYQRARDLPRRCNMRPQQCQFRVIFV
Parent Accession

Related Articles

Pubmed Authors Title Journal
N/A: See Journal Tai,S.S.K.; Lee,T.T.T.; Tsai,C.C.Y.; Yiu,T.-J.; Tzen,J.T.C. Expression pattern and deposition of three storage proteins, 11S globulin, 2S albumin and 7S globulin in maturing sesame seeds Plant Physiol. Biochem. 39 (11), 981-992 (2001)
11419730 Pastorello EA; Varin E; Farioli L; Pravettoni V; Ortolani C; Trambaioli C; Fortunato D; Giuffrida MG; Rivolta F; Robino A; Calamari AM; Lacava L; Conti A The major allergen of sesame seeds (Sesamum indicum) is a 2S albumin. J Chromatogr B Biomed Sci Appl. 2001 May 25;756(1-2):85-93
12110835 Beyer K; Bardina L; Grishina G; Sampson HA Identification of sesame seed allergens by 2-dimensional proteomics and Edman sequencing: seed storage proteins as common food allergens. J Allergy Clin Immunol. 2002 Jul;110(1):154-9
12842185 Wolff N; Cogan U; Admon A; Dalal I; Katz Y; Hodos N; Karin N; Yannai S Allergy to sesame in humans is associated primarily with IgE antibody to a 14 kDa 2S albumin precursor. Food Chem Toxicol. 2003 Aug;41(8):1165-74