Allergen

ACI47547.1

Accession ACI47547.1
Species Juglans regia
Common Name English walnut
Description lipid transfer protein (LTP) type 1
IUIS Name Jug r 3
Gi 0209484145
Length 119
Year Adopted 2011
Sequence >ACI47547.1 Allergen Jug r 3; lipid transfer protein (LTP) type 1 [Juglans regia]
MTGSLVLKLSGMVLLCMVVAAPVAEAVITCGQVASSVGSCIGYLRGTVPTVPPSCCNGVK
SLNKAAATTADRQAACECLKKTSGSIPGLNPGLAAGLPGKCGVSVPYKISTSTNCKAVK
Parent Accession