Allergen

ACK76299.1

Accession ACK76299.1
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description bactericidal permeability-increasing like
IUIS Name Der f 7
Length 213
Year Adopted 2010
Sequence >ACK76299.1 Der f 7; bactericidal permeability-increasing like [Dermatophagoides farinae]
MMKFLLIAAVAFVAVSADPIHYDKITEEINKAIDDAIAAIEQSETIDPMKVPDHADKFER
HVGILDFKGELAMRNIEARGLKQMKRQGDANVKGEEGIVKAHLLIGVHDDIVSMEYDLAY
KLGDLHPTTHVISDIQDFVVALSLEISDEGNITMTSFEVRQFANVVNHIGGLSILDPIFG
VLSDVLTAIFQDTVRKEMTKVLAPAFKRELEKN
Parent Accession

Related Articles

Pubmed Authors Title Journal
8556554 Shen,H.D.; Chua,K.Y.; Lin,W.L.; Hsieh,K.H.; Thomas,W.R. Molecular cloning and immunological characterization of the house dust mite allergen Der f 7 Clin. Exp. Allergy 25 (10), 1000-1006 (1995)
10779281 Shen,H.D.; Chua,K.Y.; Lin,K.L.; Hsieh,K.H.; Thomas,W.R. Molecular cloning of a house dust mite allergen with common antibody binding specificities with multiple components in mite extracts Clin. Exp. Allergy 23 (11), 934-940 (1993)
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53