Allergen

ADR82196.1

Accession ADR82196.1
Species Hevea brasiliensis
Common Name Para rubber tree
Description hevamine
IUIS Name Hev b 14
Gi 0313870530
Length 208
Year Adopted 2012
Sequence >ADR82196.1 Allergen Hev b 14; hevamine [Hevea brasiliensis]
GGIVIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIV
SNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWSNFLGGKSSSRPLGDAVLD
GIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLLTMYGF
NSITIHHASIAQVTLTTSLTRGIDGPHL
Parent Accession