Allergen

AER70365.1

Accession AER70365.1
Species Vespula vulgaris
Common Name wasp
Description vitellogenin
IUIS Name Ves v 6
Gi
Length 1756
Year Adopted 2020H
Sequence >AER70365.1 Allergen Ves v 6; vitellogenin [Vespula vulgaris]
MRSRFILLLLGVAVSNLDNNIEHGWKVGEEYQYLVRSRTLTGLQTLSDQYAGILMKATLR
IQCNSPDTLRAQLLKPQYAQIHKKLPDGWDSRISDQMLEHKHLPLSNEPFVIKLKHGVIR
DLIVSKNVPTWEVNIIKSIISQFQADTQGENLKGNKNTQIPEDDNPFATFRVMEDCVSGK
CEVLYDVVPLTEDVLQHRPHILPKPELRGNGEHIYITKTRNYDKCEQRMDYYFGISGNAN
WESDIRNNDKIMKKSSTSNMVISGNLKNFVIQTAVTTTEIIMKPRLVDDQESIVISKMNV
TLVSVNKVSSPIPAPNNPESTGNLVYTYNDPFSKTVQRRLGRPSVSPNSMSNELDSSADS
DEDLRLMREKYGKSDKMNVVSDEDKAFRQMKPTLHEAPKNPMLPLFIGNNGKAVVMSDKI
NSGKMVMTLVQEIASEMEDPNVMPDRETLEKFTIVSRLISSMSLEQINKAEGSLHSVWNE
IGSDETNRMKKENARAVFRDAIANAGTGPALMTIKRWIEKKEIEGCEAADVLASIPKTAR
TPTAEYVDAFFSLASNPEVQKQTCLNSSAVLSFAELVHRAQVSNSSIYNHYPVNVFGRLS
SRRNDAVLRKYIPFFAEELKKAIKDGDSPRIQVYILALGLTGHPKILNVLEPYLEGKERV
STYQRFLMVMSLRKLCEVKPSLARSVLYKIYLNTWDVHQIRCAAVNLIMRTNPPLDMLTR
MAQFTNTDFSGQVNSAVKSAIESAANLNYPEWEELTRNARKVLHLMNTESDKYYYSESHF
TEMEENDQLSYRMMLNYIGSVDNVIPLSTHFALQPSYNGFLSPVYELDMSISSVKSLLEM
YWHKSEKGDTEESFAEKTAKMLHIESDNVEQVEGNVFFKTPYLNRYFSFDNHTIERILHD
MVSPRHSHHVNMNKLLSYDITLSFPTETGLPFVYSLHVPTIKKFSVISKPDMKSKFDVRL
LTSTKHQGRVGFITPFDHQAFLSGIDNNMQVFLPCKLDFHLNNEKSRLDAALQPLKHNSK
TRLGHFSVIPYTSQYEIMSLRPLLLEKNTHRIQEKKTTHIRIPQNPNSIFSVEVEADNLA
EKIQQWLRSENKWEDMLSPSSLALGTYEKIDLFVKPDLQENEAVKFTATLDTKEIRSNNL
DTNDESWKSGNKVLKTMHQALDSPARRKEFLQEVVKGINSGKAYVIDAGLEVPGLWKSNH
ACTLCLASSNDENKFRSIFYWYTNIPSQDITYQMCVNGQTRSSPTTPFDYKKILDSNPTN
EFSINIQSGRTCTDNSLVTIKGQIKQSEDYKTYVQESRIVKRCDENVRNSVKDCQKAAEM
AKNLNEIDMTITKHNSAEESDTELEKIFHGTKKMLTGLNVRVVSEIQEHSDVNDNDIRVQ
IKLSPNMTSAEGMASKSGQILTFSDIHIDMGIDNDDEMNEIEKGILHGATCTLRNNEAET
FDGKVYPLKLGKCAHVLFTTYPRNAPNEPNKRMSIPENMKVTVIAEETENNKKELQILLG
NDEILFKSSGTEVSAWVNGQKVKCSQKESYQHIKNDETLFEIFELPGPAIKLISDKYDIK
LAYDTDHVQIEVPHTYQQSVRGLCGDFDGRSENDFVTPKNCMLQKPEEFAATYILKERCE
GPALNNAKKAERSKCIRKVLRFSDVISDGEAGRPYVNWKQWGYHKKENKKQCNTYRTQII
TKDDNICFTIRPVPTCSSGCKSVVTKLKEYQLYCLPKNDSSLGMKKRIEQGANPDLSQRT
PTDNAMISVPLECVAT
Parent Accession