Allergen

AGC39176.1

Accession AGC39176.1
Species Actinidia chinensis
Common Name gold kiwifruit
Description thaumatin-like
IUIS Name
Gi 0441482370
Length 225
Year Adopted 2014
Sequence >AGC39176.1 thaumatin-like [Actinidia chinensis]
MSTFKSLSLSALLFIAFLFTCARGATFNIINNCPFTVWAAAVPGGGKRLDRGQNWIINPG
AGTKGARVWARTGCNFDGAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFD
ISLVDGFNVAMEFSPTSGGCTRGIKCTANINEQCPNELRAPGGCNNPCTVFKTDQYCCNS
GNCGPTDYSRFFKTRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP
Parent Accession

Related Articles

Pubmed Authors Title Journal
15536427 Bublin M; Mari A; Ebner C; Knulst A; Scheiner O; Hoffmann-Sommergruber K; Breiteneder H; Radauer C IgE sensitization profiles toward green and gold kiwifruits differ among patients allergic to kiwifruit from 3 European countries. J Allergy Clin Immunol. 2004 Nov;114(5):1169-75
12417892 Gavrovic-Jankulovic M; cIrkovic T; Vuckovic O; Atanaskovic-Markovic M; Petersen A; Gojgic G; Burazer L; Jankov RM Isolation and biochemical characterization of a thaumatin-like kiwi allergen. J Allergy Clin Immunol. 2002 Nov;110(5):805-10
12165295 Wang,H.; Ng,T.B.; Isolation of an antifungal thaumatin-like protein from kiwi fruits Phytochemistry 61 (1), 1-6 (2002)
18205857 Palacin A; Rodriguez J; Blanco C; Lopez-Torrejon G; Sánchez-Monge R; Varela J; Jiménez MA; Cumplido J; Carrillo T; Crespo JF; Salcedo G Immunoglobulin E recognition patterns to purified Kiwifruit (Actinidinia deliciosa) allergens in patients sensitized to Kiwi with different clinical symptoms. Clin Exp Allergy. 2008 Jul;38(7):1220-8
18655003 Bublin M; Radauer C; Knulst A; Wagner S; Scheiner O; Mackie AR; Mills EN; Breiteneder H Effects of gastrointestinal digestion and heating on the allergenicity of the kiwi allergens Act d 1, actinidin, and Act d 2, a thaumatin-like protein. Mol Nutr Food Res. 2008 Oct;52(10):1130-9
18442249 Tuppo,L.; Giangrieco,I.; Palazzo,P.; Bernardi,M.L.; Scala,E.; Carratore,V.; Tamburrini,M.; Mari,A.; Ciardiello,M.A.; Kiwellin, a modular protein from green and gold kiwi fruits: evidence of in vivo and in vitro processing and IgE binding J. Agric. Food Chem. 56 (10), 3812-3817 (2008)
20061012 Bublin M; Pfister M; Radauer C; Oberhuber C; Bulley S; Dewitt AM; Lidholm J; Reese G; Vieths S; Breiteneder H; Hoffmann-Sommergruber K; Ballmer-Weber BK Component-resolved diagnosis of kiwifruit allergy with purified natural and recombinant kiwifruit allergens. J Allergy Clin Immunol. 2010 Mar;125(3):687-94, 694.e1
23289429 Maddumage,R.; Nieuwenhuizen,N.J.; Bulley,S.M.; Cooney,J.M.; Green,S.A.; Atkinson,R.G.; Diversity and relative levels of actinidin, kiwellin, and thaumatin-like allergens in 15 varieties of kiwifruit (Actinidia) J. Agric. Food Chem. 61 (3), 728-739 (2013)
23141741 Le TM; Bublin M; Breiteneder H; Fernández-Rivas M; Asero R; Ballmer-Weber B; Barreales L; Bures P; Belohlavkova S; de Blay F; Clausen M; Dubakiene R; Gislason D; van Hoffen E; Jedrzejczak-Czechowicz M; Kowalski ML; Kralimarkova T; Lidholm J; DeWitt AM; Mills CE; Papadopoulos NG; Popov T; Purohit A; van Ree R; Seneviratne S; Sinaniotis A; Summers C; Vázquez-Cortés S; Vieths S; Vogel L; Hoffmann-Sommergruber K; Knulst AC Kiwifruit allergy across Europe: clinical manifestation and IgE recognition patterns to kiwifruit allergens. J Allergy Clin Immunol. 2013 Jan;131(1):164-71