Allergen

AGC56219.1

Accession AGC56219.1
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description ferritin
IUIS Name Der f 30
Length 171
Year Adopted 2014
Sequence >AGC56219.1 Der f 30; ferritin [Dermatophagoides farinae]
MAANPESTTKTSRVRMNIQINLEFYASYVYQQMAYHFNRDDVALPGFEKFFDVSSKEERE
HAERFMKLQNQRGGRIVLDDIHKPQQQDWSSGLEAMRAALELEKTVNQALLDLHAVATKH
NDAQFADFIETHYLTEQVEAIKKLADYITNLERCGPGLGEYLFDRHTLHSS
Parent Accession

Related Articles

Pubmed Authors Title Journal
12220473 Epton,M.J.; Smith,W.; Hales,B.J.; Hazell,L.; Thompson,P.J.; Thomas,W.R.; Non-allergenic antigen in allergic sensitization: responses to the mite ferritin heavy chain antigen by allergic and non-allergic subjects Clin. Exp. Allergy 32 (9), 1341-1347 (2002)
23481662 An S; Chen L; Long C; Liu X; Xu X; Lu X; Rong M; Liu Z; Lai R Dermatophagoides farinae allergens diversity identification by proteomics. Mol Cell Proteomics. 2013 Jul;12(7):1818-28
N/A: See Journal R Goodman and Su An Dermatophagoides farinae seq and paper inquiries Correspondence Email 1