Allergen

AHX03180

Accession AHX03180
Species Dermatophagoides farinae
Common Name American house dust mite
Description alpha-amylase
IUIS Name Der f 4
Gi
Length 525
Year Adopted 2022
Sequence >AHX03180 Allergen Der f 4; alpha-amylase [Dermatophagoides farinae]
MLPKFFFILITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGP
YGYGGVQVSPVNEHAIMDGRPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVD
IVLNHMTGGQSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEAR
NCRLVGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLN
NEFFTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNF
GTEWGLVPSGDALVMIDSHDLRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMS
SYFWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKL
IAGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDII
SGNLINNRCMGKSIQVDKNGLSDIYVGHDEFDAFVAYHIDARVES
Parent Accession