Allergen

AII81930

Accession AII81930
Species Blattella germanica
Common Name German cockroach
Description chitinase
IUIS Name Bla g 12
Gi
Length 539
Year Adopted 2022
Sequence >AII81930 Allergen Bla g 12; chitinase [Blattella germanica]
MKTSQILFLCGVVFLSVLVSTSGDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLI
YSFIGVSNVTWGPLILDQENDVDLRGFLNFTDLKAKGVKTSVAMGGWGEGGRKYSHLVSD
KKLRDTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEG
KGWEITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEG
YGYQALNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDA
GPYTGAKGMLAYYEICNMLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMD
FIKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVLAKNMKDYVVPTLQISTTPRPEWDRPK
STTFEGGSVTTSTTTTTTMKTTIPETTTTGTTTSTIDPTITTPSFPPSETTTDATTGGPT
VTPSCANANFYPAANCNQYYMCNQGTPILMTCPSGTVWVQEGIRCDWPAASTRAECRSA
Parent Accession