Allergen

AIO08849.1

Accession AIO08849.1
Species Dermatophagoides farinae
Common Name House dust mite
Description secreted inorganic pyrophosphatase
IUIS Name Der f 32
Gi
Length 296
Year Adopted 2021
Sequence >AIO08849.1 Allergen Der f 32; secreted inorganic pyrophosphatase [Dermatophagoides farinae]
MSTTNYSVDHRGSFNSLDYRIYFKDNSNGKIISPWHDIPLFVDKSAK
HYNMVVEIPRWTNEKMEIATAEPMSPIKQDIKKGALRYVKNVFPHKG
YIWNYGAFPQTWENPNHIDQDTKTKGDNDPIDVIEIGSRVAKRGDVV
PVKILGTIALIDEGETDWKIIAIDTRDELASQMNNVDDVEKLLPGLL
RATVEWFKIYKIPDGKPANKFAFNGEAKDREFAEKIVEETHQYWQEM
MENKSGEHKLDLKNVTLGNSFSINDEQAKQFLETRPSSDAVEPTPIA
DQVAIDKWHHVKLI
Parent Accession