Allergen

APP94292.1

Accession APP94292.1
Species Scylla paramamosain
Common Name green mud crab
Description triose-phosphate isomerase
IUIS Name Scy p 8
Gi
Length 248
Year Adopted 2021
Sequence >APP94292.1 Allergen Scy p 8; triose-phosphate isomerase [Scylla paramamosain]
MANQRKFFVGGNWKMNGDKAAIDGIISFMKGPLNADTEVVVGCPQCYLMYT
REHMPANIGVAAQNCYKTAKGAFTGEISPAMIKDCGCEWVILGHSERRNVF
GEPDQLISEKVGHALEAGLKVIPCIGEKLEERESNRTEEVVFAQMKALVPN
ISDWSRVVIAYEPVWAIGTGKTATPEQAQDVHAKLRQWLRDNVSPQVAEST
RIIYGGSVSAGNCKELAKTGDIDGFLVGGASLKPDFVTIINARA
Parent Accession