Allergen

AVV30163.1

Accession AVV30163.1
Species Olea europaea
Common Name Olive tree
Description cyclophilin
IUIS Name Ole e 15
Gi
Length 172
Year Adopted 2021
Sequence >AVV30163.1 Allergen Ole e 15; cyclophilin [Olea europaea]
MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGK
PLHYKGSAFHRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGP
GILSMANAGPGTNGSQFFICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVG
SGSGKTAKPVVVADCGQLS
Parent Accession