Allergen

BBD75204.1

Accession BBD75204.1
Species Dermatophagoides farinae
Common Name American House Dust Mite
Description Apolipophorin Putative Der f 14
IUIS Name
Gi
Length 1666
Year Adopted 2019
Sequence >BBD75204.1 Apolipophorin Putative Der f 14 [Dermatophagoides farinae]
MRLFALLFTACLLGLGQAQHCTVACPNSIPQLINPKAQSTYVYTLDAKTVLTPRDSQKVT
IKADAEVAIVSACEAVLRLQNVAIDGVPNGAELASELASKSFAFGYFNGRILGVCPANDD
QDWSLNIKKAIVSALQVQFDENKDKVEESDFSGRCPTEYRKIRNEDNMVVMEKRKDLNLC
DDRRIDLRQTPDQALGQLKEMIRHYMHPMGSDLSCRMTLKDQVVSEVDCEERHVLVHRSH
KPVHLSYVKMMLKESKDGVAADLGQTDSEPKRPYLSFDHKHKNPTETDVVEVLKKLCSEI
SEPQASIETSFTFQKLVDKLRYLSAEETASVDESVKTSVCPAHAYRIRELFLDASAFAAS
DGSIRTLVKAHENQELSITRSTALFTVVAMKAAPNKETVQVLLPVIASEKTIRPMLLGFS
VLVRRYCEKSADCASNSGVKDARDAYLARLATAKDANERITIVRALENLNVNTEGVDNMI
NAMDEIIKSDAEPALRAAAVNALSNDASHMDRYKSLVMDESMPNEARIAAFQKMMKNGGM
SHIKDLFTVKGECMKNYVLTYVDNLKKSKNDLRRQTVSGDVELPEQPKREIGITRNIARE
YGPYTFEYDVIYPETHENVTRSINGRLIRAKNDQLKEIVEIQITQNGFERELTNAMALME
KKSFQSIMQFVRDTLKMLAQIRKNADDNHHMKITVQINGKDVYYTDVFQDLKKMKELIIK
RAEKIINEKKVDRSIGGVLLDSKLVLPTITGLPLMYKFGDNFLIRYDGEFSGEKGDRHIK
LNGGFVAGVYGQMKLLVKDQKMGYEYDGKLAYTPILDMDIQKKEHSLLLRFNTKDVERRT
IMRFKQSLREKRATGEEKDYENEITPESRSDQCFSFFLLDYCRKASHIKGLIFPNVEYYV
VKPEKEVTALELLLKGETEDKTRRYVAELTAVGSPSNKQAKAQIEVTKGEEYKITLKSPE
HEFNTEFTIHADKNNLKMHMDFPNVFQADLTGTFQHDKENNVRKNQLNLQYKFAGDEKPH
TVDYENEFSFNLKRSSKDKNSGVDYRAKYMSSHFPILNHKVNIQFKYRPFKVNELNLEGE
FGRELQHKFQLMRNSQIEVEEVRPFKMHGNSDIKLMANDLDIDYDLKSEFKYESNKGTPI
ELQYKISGKDRSKRAADLGAEDVEGVIDYKNNGSPIDSKMHAHLKMKGNNYGYDSELKQT
QPQQYEGKITLSKNDKKIFINHKSEMTKPTNTFHLKTDADVSYSDSDMKKHYQMEFKKEN
DIYTMRSTVERNGQMFYENHLTIHKGGKLNLNYRRNDRKILLDLDNALSPREGTMKLNIK
DREYNFVMKREPLRFRDITVEGNENAYIKNGKLHLSLMDPSTLSLVTKADGKIDMTVDLI
SPVTKRASLKIDSKKYNLFHEGELSASIVNPRLSWHQYTKRDSREYKSDVELSLRSSDIA
LKITMPDYNSKIHYSRQGDQINMDIDGTLIEGHAQGTIREGKIHIKGRQTDFEIESNYRY
EDGKLIIEPVKSENGKLEGVLSRKVPSHLTLETPRVKMNMKYDRYAPVKVFKLDYDGIHF
EKHTDIEYEPGVRYKIIGNGKLKDDGRHYSIDVQGIPRKAFNLDADLMDFKLKVSKPEDS
NKAQFSYTFNEYTETEEYEFDPHRAYYVNWLSSIRKYIQNFIVEDN
Parent Accession
Notes This record (Accession# BBD75204) replaces two Accessions#: P39673.1 and BAA04558.1 In previous versions of COMPARE; which were imported from AOL v.16 when building the first version of COMPARE